PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT20593
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 365aa    MW: 40553.1 Da    PI: 6.428
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT20593genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.72.8e-50301602128
       NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....kg 97 
                pG+rFhPtdeelv++yL++kv++k+l++ evi+e+diyk++PwdLp +++ ++ekewyfF+ r +ky+++ r+nr+t sg+Wkatg d++++s+    +g
  EMT20593  30 LPGYRFHPTDEELVTFYLRRKVAKKSLRI-EVIREMDIYKHDPWDLPkASTVGGEKEWYFFCLRGRKYRNSIRPNRVTGSGFWKATGIDRPIYSAaaggSG 129
               69***************************.99***************445556889**************************************9988778 PP

       NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 +glkk+Lv+y+g+a kg+ktdW+mhe+rl
  EMT20593 130 VSIGLKKSLVYYRGSAGKGTKTDWMMHEFRL 160
               88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100554.47129188IPR003441NAC domain
SuperFamilySSF1019412.62E-5529187IPR003441NAC domain
PfamPF023659.1E-2531160IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MSAIEMEKAT SDGEVVLGAG DEEDDDDVVL PGYRFHPTDE ELVTFYLRRK VAKKSLRIEV  60
IREMDIYKHD PWDLPKASTV GGEKEWYFFC LRGRKYRNSI RPNRVTGSGF WKATGIDRPI  120
YSAAAGGSGV SIGLKKSLVY YRGSAGKGTK TDWMMHEFRL PPAAAPATNA SPSMQEAEVW  180
TICRIFRRTI TYRKQQTWRP APAPSTAITA ADSSSNTGSF ESSEGGDEYM NCLQAPAAAA  240
PCIPQQQHQY VSQTGTVNSG NFFYRDTMHN QQFQGQWNAP PAGPMPEQKP QNPLSTADSF  300
HQNEHSLAVA TNDFHKVEAL DGYLEEIARM MEVTDPAGFY DYRSYGSSAG NRGPSFERTL  360
HSSAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-473119417174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3604320.0AK360432.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1118B07.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981565.11e-163PREDICTED: transcription factor JUNGBRUNNEN 1
SwissprotQ9SK555e-87NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBLN1R4A60.0N1R4A6_AEGTA; NAC domain-containing protein 42
STRINGMLOC_66348.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43000.11e-76NAC domain containing protein 42